PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN32255.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 223aa    MW: 25458.8 Da    PI: 9.2291
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN32255.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.7e-171360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+++Ed++lvd++k++G  +W+t ++  g++R++k+c++rw +yl
       KHN32255.1 13 KGAWSKQEDQKLVDYIKKHGEVCWRTLPQAAGLHRCGKSCRLRWINYL 60
                     79******************99************************97 PP

2Myb_DNA-binding51.52.3e-1666110147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++
       KHN32255.1  66 RGNFAEDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSH 110
                      8999******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.68860IPR017930Myb domain
SuperFamilySSF466895.86E-2811107IPR009057Homeodomain-like
SMARTSM007171.4E-131262IPR001005SANT/Myb domain
PfamPF002494.0E-141360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-221467IPR009057Homeodomain-like
CDDcd001673.93E-101560No hitNo description
PROSITE profilePS5129426.29761115IPR017930Myb domain
SMARTSM007174.1E-1565113IPR001005SANT/Myb domain
PfamPF002497.1E-1566110IPR001005SANT/Myb domain
CDDcd001671.32E-1068111No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2568116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MRKPSCDIKE LNKGAWSKQE DQKLVDYIKK HGEVCWRTLP QAAGLHRCGK SCRLRWINYL  60
RPDLKRGNFA EDEEDLIIKL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH IRKKLISNGI  120
DPNNHRLNHT IPSVYQNPPM SDDSSKHFGM KDNNSKNETS KSPRVYNHGE VSDAASGEAE  180
SSCALPDLNL DLSICEKNLK PFHESKLSRK VPFDSPSTLL LFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-3081152108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT6991081e-111KT699108.1 Trifolium repens MYB133 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003556646.11e-166PREDICTED: transcription factor MYB3-like
SwissprotP813936e-74MYB08_ANTMA; Myb-related protein 308
SwissprotQ9S9K98e-74MYB3_ARATH; Transcription factor MYB3
TrEMBLA0A0B2RG931e-166A0A0B2RG93_GLYSO; Transcription factor MYB3
TrEMBLK7N0Q31e-166K7N0Q3_SOYBN; Uncharacterized protein
STRINGGLYMA20G01610.21e-165(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.15e-75myb domain protein 3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]